PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen05g006790.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 215aa    MW: 25124.4 Da    PI: 9.1081
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen05g006790.3genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.33.2e-31959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krienk+nrqvtf+kRrng+lKKA+ELS+LCdae+a+iifss+gklye++s
  Sopen05g006790.3  9 KRIENKINRQVTFAKRRNGLLKKAYELSILCDAEIALIIFSSRGKLYEFCS 59
                      79***********************************************96 PP

2K-box95.67.9e-32791735100
             K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                       +g+ ++++++++ +qe+ kLk ++e Lq++qRhllGedL++L  k+L+qLe+qL++sl++iRs+K++++l+q+ elq+ke++l e nk+Lr k
  Sopen05g006790.3  79 EGT-QTSSDSQNNYQEYLKLKTRVEVLQQSQRHLLGEDLGQLGTKDLEQLERQLDSSLRQIRSTKTQHILDQLAELQQKEQSLTEMNKSLRIK 170
                       455.578889**********************************************************************************9 PP

             K-box  98 lee 100
                       lee
  Sopen05g006790.3 171 LEE 173
                       986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.417161IPR002100Transcription factor, MADS-box
SMARTSM004329.2E-42160IPR002100Transcription factor, MADS-box
CDDcd002656.53E-44278No hitNo description
SuperFamilySSF554555.49E-34284IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-33323IPR002100Transcription factor, MADS-box
PfamPF003193.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-333859IPR002100Transcription factor, MADS-box
PfamPF014861.5E-2782171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.02787177IPR002487Transcription factor, K-box
Gene3DG3DSA:3.10.150.101.4E-4151211No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MGRGKVELKR IENKINRQVT FAKRRNGLLK KAYELSILCD AEIALIIFSS RGKLYEFCSN  60
SSMSKTLERY HRYNYGTLEG TQTSSDSQNN YQEYLKLKTR VEVLQQSQRH LLGEDLGQLG  120
TKDLEQLERQ LDSSLRQIRS TKTQHILDQL AELQQKEQSL TEMNKSLRIK LEELGVTFQT  180
SWHCGEQSVQ YRHEQPSQHE GFFQHVNCNN TLPIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A2e-289217322103Developmental protein SEPALLATA 3
4ox0_B2e-289217322103Developmental protein SEPALLATA 3
4ox0_C2e-289217322103Developmental protein SEPALLATA 3
4ox0_D2e-289217322103Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4485220.0AF448522.1 Lycopersicon esculentum MADS-box transcription factor MADS-RIN (MADS-RIN) mRNA, complete cds.
GenBankAF4485230.0AF448523.1 Lycopersicon esculentum MADS-box transcription factor MADS-rin mRNA, complete cds.
GenBankDQ1577960.0DQ157796.1 Lycopersicon esculentum cultivar Punjab Kesari MADS-box transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015075018.11e-157PREDICTED: MADS-box protein CMB1 isoform X2
SwissprotQ396852e-95CMB1_DIACA; MADS-box protein CMB1
TrEMBLQ8S4L31e-153Q8S4L3_SOLLC; MADS-box transcription factor MADS-rin
TrEMBLQ8S4L41e-155Q8S4L4_SOLLC; MADS-box transcription factor
STRINGSolyc05g012020.2.11e-154(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.12e-87MIKC_MADS family protein